PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 340aa    MW: 37758.4 Da    PI: 6.5061
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2173genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+++k++G g+W++ +r  g++R++k+c++rw +yl
      Gh_D05G2173 14 KGPWTPEEDQKLVHYIKRHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.41.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D05G2173  67 RGKFSQDEEQTILHLHSVLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.6961IPR017930Myb domain
SuperFamilySSF466891.98E-3111108IPR009057Homeodomain-like
SMARTSM007171.5E-151363IPR001005SANT/Myb domain
PfamPF002491.6E-171461IPR001005SANT/Myb domain
CDDcd001671.39E-121661No hitNo description
PROSITE profilePS5129426.57162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2765117IPR009057Homeodomain-like
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.09E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRSACCDEN GLKKGPWTPE EDQKLVHYIK RHGHGSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQDEEQTILH LHSVLGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
IDPMTHQPRT DIFASLPQLI ALANLKDLLE NSPHLFDDQA LILQAEAAHL AKLQYMQLLL  180
HSAASTTTND DSLSSPNGIA DMEALNLLSS PVPAHVKENP VIPNSSQFSV GNASSQQLHH  240
PTLLPHLLDP QVPFSFQTSL NNENTEMGNY SSFTILSQGD NQIDNSSPWL LPSPTIPPTA  300
TETSLSNPGD VSSNSSNNNG AVSPYWPELY FDDSIMHEIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446369.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLA0A0D2QM690.0A0A0D2QM69_G
STRINGPOPTR_0005s17080.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-123myb domain protein 93